PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029768-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NF-YB
Protein Properties Length: 181aa    MW: 20582.3 Da    PI: 6.3397
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029768-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB173.62e-5418112195
                  NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylk 88 
                            vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+tsea+d+cqre+rkti+++d+lwa+++lGf+dy+epl+vyl+
  SMil_00029768-RA_Salv  18 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLH 105
                            69************************************************************************************** PP

                  NF-YB  89 kyreleg 95 
                            +yre++g
  SMil_00029768-RA_Salv 106 RYREFDG 112
                            ****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.4E-5113111IPR009072Histone-fold
SuperFamilySSF471132.79E-3821113IPR009072Histone-fold
PfamPF008083.6E-262488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.4E-175270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.4E-177189No hitNo description
PRINTSPR006151.4E-1790108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MSMGHTNQHG GEESECMVRE QDRFMPIANV IRIMRKILPP HAKISDDAKE TIQECVSEYI  60
SFITSEANDR CQREQRKTIT AEDVLWAMSK LGFDDYIEPL TVYLHRYREF DGGSLRGEPL  120
VKRMVDHASM GFHGFPPPAF HHHGFFGAAT MNFFKDSPNA GPSQQAAVAC IEPFPQHKDQ  180
L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3919109393NF-YB
4awl_B1e-3919109494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3919109494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095910.11e-98PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W661e-64NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A118JXB59e-90A0A118JXB5_CYNCS; Uncharacterized protein
STRINGVIT_00s0956g00020.t013e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.25e-66nuclear factor Y, subunit B6